PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G364600.1.p
Common NameSETIT_004575mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 246aa    MW: 25789.1 Da    PI: 6.713
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G364600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.51.5e-40571561100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l ++ e er da+sslvyeA+ r+rdPvyG++g i+ lqqq++ l+
  Seita.5G364600.1.p  57 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVAEGERADAASSLVYEANLRLRDPVYGCMGAISVLQQQVNALE 147
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ael+++++e
  Seita.5G364600.1.p 148 AELEAVRAE 156
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.05756157IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4057154IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSTERERLDE IGKKIKREPD TATLALAAAS ASTAPADSRV PRRVGLGLGG ALNTVTPCAA  60
CKLLRRRCAQ ECPFAPYFSP HEPHKFAAVH KVFGASNVSK MLLEVAEGER ADAASSLVYE  120
ANLRLRDPVY GCMGAISVLQ QQVNALEAEL EAVRAEILKH RYQQAGAAGA SLVDDDTHAT  180
GSFVAPAPAP VHARDVVSVV ETAGQGVAAT APGMSAVYVA EAEQRPSSNH YGALNNPSEH  240
AAYFG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0686991e-170BT068699.1 Zea mays full-length cDNA clone ZM_BFb0375M24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970407.11e-179PREDICTED: LOB domain-containing protein 15-like
SwissprotQ9AT613e-72LBD13_ARATH; LOB domain-containing protein 13
TrEMBLK3XRN11e-176K3XRN1_SETIT; Uncharacterized protein
STRINGSi004575m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-64LOB domain-containing protein 15